SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000009765 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000009765
Domain Number 1 Region: 2-472
Classification Level Classification E-value
Superfamily ALDH-like 1.3e-159
Family ALDH-like 0.00000000000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000009765   Gene: ENSOGAG00000010908   Transcript: ENSOGAT00000010912
Sequence length 477
Comment pep:novel scaffold:OtoGar3:GL873525.1:31138821:31179576:1 gene:ENSOGAG00000010908 transcript:ENSOGAT00000010912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFINNEWHDSVSGKKFPVLNPATEETICHVEEGDKEDVDKAVKAARQAFQIGSPWRTMDA
SERGRLLYKLADLIERDRLLLATMEALNGGKLFSSAYLMDVEVGVKALRYCAGWADKIQG
RTIPADGNVFTYTRHEPIGVCGQINPWNFPLITLIMKIAPALSCGNTVIVKPAEQTPLTA
LQVASLIKETNFMPTLINPQSRGGKREKASVSQQFSERTVMDTTEVGKLIKEAAGKSNLK
RVTLELGGKSPCIVFADADLDNALEFAHRGVFFHQGQCCVAASRLFVEESIYDEFVKRSV
ELAKKYVLGNPLTPGVSQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFIQP
TVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTHYGLAAGVFTKDLDKAITVS
SALQAGAVWVNCYMMISSQCPFGGYKMSGNGREMGEYGLYEYTEVKTVTMKISQKNS
Download sequence
Identical sequences H0X3P5
ENSOGAP00000009765 ENSOGAP00000009765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]