SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010052 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010052
Domain Number 1 Region: 243-660
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 2.42e-93
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00042
Further Details:      
 
Domain Number 2 Region: 105-241
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.76e-37
Family Ferredoxin domains from multidomain proteins 0.00024
Further Details:      
 
Domain Number 3 Region: 32-104
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.56e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010052   Gene: ENSOGAG00000011226   Transcript: ENSOGAT00000011229
Sequence length 727
Comment pep:known_by_projection scaffold:OtoGar3:GL873532.1:24896823:24931978:1 gene:ENSOGAG00000011226 transcript:ENSOGAT00000011229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRIPVRRALMGLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFL
LANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCT
RCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTA
RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQ
RLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDLLNR
VDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRK
SWLHNDLKVALIGSPVDLTYTYDHLGDSPRILQDIASGSHSFSQVLKEAKKPMVVLGSSA
LQRSDGAAILAAVSNIAQKIRMTSGVTSDWKVMNILHRVANQVAALDLGYKAGVEAIRKN
PPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVIFPGAAYTEKSATYVNME
GRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLPYDTLDQVRNRLEEVSPNLVRYDDVE
GANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDAISRASQTMAKCVKAVTEGAQA
VEEPSIC
Download sequence
Identical sequences H0X4D4
ENSOGAP00000010052 ENSOGAP00000010052 XP_003785053.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]