SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010156 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010156
Domain Number 1 Region: 50-296
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.71e-91
Family Carbonic anhydrase 0.0000000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010156   Gene: ENSOGAG00000011336   Transcript: ENSOGAT00000011341
Sequence length 315
Comment pep:known_by_projection scaffold:OtoGar3:GL873570.1:1374647:1405240:1 gene:ENSOGAG00000011336 transcript:ENSOGAT00000011341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVMNSLRGILQAAPHKLLWRKFQILRCMPARLCSLYTCTYKTRNRALHPLWENADLVPA
GDRQSPINIRWRDSVYDPGLKPLTISYDPNTCLHIWNNGYSFLVEFEDSTDKSVIKGGPL
EHKYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNAVKFESFEDAALEENGLAVI
GVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGLFDPSCLMPTCPDYWTYAGSLTTPPLS
ESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDY
VLNIHVKTPSLQPAK
Download sequence
Identical sequences H0X4M2
ENSOGAP00000010156 ENSOGAP00000010156 XP_012661887.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]