SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010206 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010206
Domain Number 1 Region: 515-708
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.28e-58
Family Hemopexin-like domain 0.0000000178
Further Details:      
 
Domain Number 2 Region: 88-215,389-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.67e-32
Family Matrix metalloproteases, catalytic domain 0.000000801
Further Details:      
 
Domain Number 3 Region: 335-390
Classification Level Classification E-value
Superfamily Kringle-like 1.28e-21
Family Fibronectin type II module 0.00013
Further Details:      
 
Domain Number 4 Region: 274-331
Classification Level Classification E-value
Superfamily Kringle-like 4e-21
Family Fibronectin type II module 0.00011
Further Details:      
 
Domain Number 5 Region: 218-273
Classification Level Classification E-value
Superfamily Kringle-like 3.71e-20
Family Fibronectin type II module 0.00017
Further Details:      
 
Domain Number 6 Region: 31-104
Classification Level Classification E-value
Superfamily PGBD-like 6.91e-18
Family MMP N-terminal domain 0.0000629
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010206   Gene: ENSOGAG00000011394   Transcript: ENSOGAT00000011397
Sequence length 709
Comment pep:known_by_projection scaffold:OtoGar3:GL873542.1:8084464:8091502:1 gene:ENSOGAG00000011394 transcript:ENSOGAT00000011397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSWPPLVLALLVLGCCSVAPRPHQPTFVVFPRDLKSNLTDRQLAEEYLYRYGYTRVAEM
HGETLSLRSSLLMLQKRLSLPQTGELDSTTLEAMRTPRCGVPDMGKFQTFEGDLKWHHHN
ITYWIQNYSDDLPRSVTDDAFARAFAVWSAVTPLTFTRVYGREADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVKTYYGNADGAPCHFPFTFEGRS
YSACTTDGRSDDTPWCSTTANYDTDRRFGFCPSERLYTQDGNADGKPCHFPFIFEGKSYS
ACTTAGRSDGYRWCATTGNYDQDKLYGFCPSRVDSTVIGGNAAGELCVFPFVFLGKEYST
CTSEGRTDGRLWCATTSNFDTDRKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEEPPLHADDVNGVQHLYGPGPAPDPRPPATTTPEPQPTAPMTVCPTGPPTAYPS
ERPTTGPTGPPSAGPTGPPTAGPTEAPTVSLDPADDACNVNIFDAIVEIGNRLHFFKDGR
YWRFSDSRGRRLQGPFLIANTWPALPPKLDSGFEEPLTKKIFFFSGRQVWVYTGGSVLGP
RRLDKLGLGSEVAHVTGALPRAAGKVLLFSGQHFWRFDVKTQMVDPRSATAVDQMFPGVP
LNTHDIFQYREKAYFCQDRFYWRVSSRSEVNQVDFVGYVTYDILQCPEE
Download sequence
Identical sequences H0X4Q6
XP_003787712.1.62490 ENSOGAP00000010206 ENSOGAP00000010206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]