SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010219 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010219
Domain Number 1 Region: 282-630
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.21e-86
Family YicI catalytic domain-like 0.000075
Further Details:      
 
Domain Number 2 Region: 632-714
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 8.63e-22
Family Putative glucosidase YicI, domain 3 0.0068
Further Details:      
 
Domain Number 3 Region: 134-279
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000000000000173
Family YicI N-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010219   Gene: ENSOGAG00000011407   Transcript: ENSOGAT00000011413
Sequence length 852
Comment pep:known_by_projection scaffold:OtoGar3:GL873659.1:3726787:3749842:1 gene:ENSOGAG00000011407 transcript:ENSOGAT00000011413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAAVAARRRRLSISGRDDNSVELTVADGPYKIILTARPFRLDLLEDRSLLLSVNARG
LLEFEHQRAPRVSFSDKVSLTLGSMWDKIKNLFSRQGSKDPAEGDGAQPEETPGDGDKLE
ETQGKAEKDEPGAWEETFKTHTDSKPYGPMSVGLDFSLPGMEHVYGIPEHADNLRLKVTE
GGEPYRLYNLDVFQYELYNPMALYGSVPVLLAHNPHRDLGVFWLNAAETWVDISSNTAGK
TLFGKMLDYLQGSGETPQTDVRWMSETGIIDVFLLLGPSISDVFRQYASLTGTQALPPLF
SLGYHQSRWNYRDEADVLEVDQGFDDHNLPCDVIWLDIEHADGKRYFTWDPSRFPQPHTM
LEQLASKRRKLVTIVDPHIKVDSGYRVHEELRNLGLYIKTRDGSDYEGWCWPGSAGYPDF
TNPTMRAWWANMFSYDNYEGSAPNLYVWNDMNEPSVFNGPEVTMLKDAQHYGGWEHRDLH
NIYGLYVHMATADGLTLRSGGIERPFVLSRAFFAGSQRFGAVWTGDNTADWDHLKISIPM
CLSLGLVGLSFCGADVGGFFRNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQ
HHDTIRDALGQRYSLLPFWYTLFYQSHREGIPVMRPLWVQYPQDVTTFSIDDQFLLGDAL
LVHPVSDSGAHGVQVYLPGQGEVWYDVQSYQKHYGPQTLYLPVTLSSIPVFQRGGTIVPR
WMRVRRSSDCMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTHHEFLLRRFSFSGNAL
VSSSADPKGHFETPIWIERVVIIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLILRKPG
VNVASDWSIHLR
Download sequence
Identical sequences H0X4R7
ENSOGAP00000010219 ENSOGAP00000010219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]