SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010300 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010300
Domain Number 1 Region: 89-234,389-453,526-592,641-744
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.06e-50
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 
Domain Number 2 Region: 200-447
Classification Level Classification E-value
Superfamily Nucleoporin domain 5.23e-16
Family Nucleoporin domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010300   Gene: ENSOGAG00000011496   Transcript: ENSOGAT00000011506
Sequence length 1537
Comment pep:known_by_projection scaffold:OtoGar3:GL873619.1:5897133:5950873:1 gene:ENSOGAG00000011496 transcript:ENSOGAT00000011506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGPGGFARTDATEKLPSVMAGVPARRGQSSPPPAPPLCLRRRTRPPTAPEDTMHHRV
SLEKVLGITAQNSSGLTCDPSTGHVAYLAGCVVVILNPKENKQQHIINTARKSLSALAFS
PDGKYIVTGENGHRPAVRIWDVEEKTQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMV
LNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGSRNVRFWFLEVSTETKVTGTVPL
IGRSGILGELHNNIFCGVACGRGRMAGNTFCVCYSGLLCQFNEKRVLEKWINLKVSLSSC
LCVSEELIFCGCTDGIVRIFQAHSLHYLANLPKPHYLGIDVAQGLEPSFLFRRKAEAVYP
DTVALTFDPIHQWLSCVYKDHSIYIWDVKDIDKVSKVWSELFHSSYVWNVEVYPEFEDQR
ACLPSGSFLTCSSDNTIRFWNMDSTPDCHWQKNIFSNTLLKVVYVENDIQHLQDMSHFPD
RGNKNGTPVDVKAGVRVMQVSPDGQHLASGDRSGNLIHELHFMDELVKVEAHDAEVLCLE
YSKPETGLTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGNRDIQMISCGA
DKSIYFRSAQRASDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRIYNTVSGK
QKKCYRGSQGDEGSLLKVQVDPSGTFLATSCSDKSISVIDFYSGECIAKMFGHSEIVTGM
KFTYDCRHLITVSGDSCVFIWHLGPEITSCMKQHLLEIDHRDQQQQQQQQHTKSRKWSNH
PRQETYVSVPREIRSLSPGEQTEDELEEECEQEDLLKTPSKENLDPDPRCLLTNGKLPLW
AKRLLGDEDVADGSAFHAKRSYQPHGRWAERADQEPLKTILDARDLDCYFTPMKRESLED
SLLVTVEPQNLASLLNESESPQENSCGHPSFLSQQRESSEASELIIYALEAEVTVTGMDS
EYCNKEAEEGLGDQHGDSYLRVSSISSKDQSPPEDSEDSEADLECSSAAACCSPPQPDPD
PRFAMATPPTPECPGTTGEELSQPEGLGLSNSSLPQTPEQEKFLRHHFETLTDSHPEELF
HGSLRDLKASETEDYFNPRLSISAQFLSSLRKTSRFPHTFPPQLPQHLMKSPEVKPTDRG
GSQPRAEPLRAGTGYTSPDGTNILSVGEAEEALLAVRAPSASFSAPCLTDLAPRVPSSSV
LPTDRKPPAPASVPTLGLAQGIHVPSTCSYMEATASSRAKVSRSISLGDSERPVMAELAR
PLRRPSSMGELASLGQKLQAITTTPTSNSDSEGQESAVHSWGNHDARASLRLTLSSVCDR
LLLPQSLPDPPTTVATASFPSPSPVDVSTLRLHGSAFLPRFPACEPCDPPAQPNIPQLPE
ARPGAPDNTVTLLEHSPDVLRLSWGSPGHWGEPGVPAEALSPAPLELSSVGNILHRLQTA
FQEALDLYHMLVSTDQIDAGLQQVQTELASTFLWIHSQLEANNWLVGTDVAPAQASSRPR
PPSPPTLCPLASPDLHALLEHYSELLVQAVRRKVRGD
Download sequence
Identical sequences H0X4Y4
ENSOGAP00000010300 ENSOGAP00000010300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]