SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010519 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010519
Domain Number 1 Region: 406-580,613-709
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 3.01e-57
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00042
Further Details:      
 
Domain Number 2 Region: 1123-1179
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 9.16e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 3 Region: 709-752
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000994
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010519   Gene: ENSOGAG00000011753   Transcript: ENSOGAT00000011757
Sequence length 1179
Comment pep:novel scaffold:OtoGar3:GL873543.1:6875040:6986908:1 gene:ENSOGAG00000011753 transcript:ENSOGAT00000011757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSANPGNWVTFDDDPTFQSSQKSKILPLENQGVCRPNGLKLNLSGLKEFPSGPSSTSST
PLSSPVVDRYFSPGPPSNSPLSTPTKDFPGIPGIPKAGTHLLYPIPESSSNSPLTTPGAG
SSSLPTKPTCLSQAFLPSGHPCTYPAPKVGLPDETSSHQAESLGFQSDNAPQFQYFQEDC
AFSSPFWKGEGSVFQFTFDPPGSRKIFSSRDKEILIDQKSLNKCSLNYICEKLEHLQSTE
NQDSPGSLSMRHVCAQDTASSFVPRALFRSQPKVGWSFMLRIPEKKNMMSSRQWGPIFLK
VLPGGILQMYYEQGLEKPFKELQLDPHCRLSEPKVENFSVTGKIHTVKIEHMSYTEKRKY
HSKTEVVHEPDVEQMLKLGSTEYRDFLDFLTTVEEELVKLPAVSKPKKSYEEQEISLEIV
DNFWGKVTKEEGKLVESAVITQIYCLCFVNGNMECFLTLNDLELQKQDACYFENNPEKKG
IDILDYHFHKCVKVQEFEQSRIIKFVPLDACRFELMRFKTLYHGDNLPFSVKSVVVIQGA
YVELQAFINMLPLAQRPSHEGSLRSCDNIMIHFPVPSQWIKALWTMNLQRQKSLKAKMNR
RACLGSLHEPEADPVIQVTVGSAKYESAYRAVVWKIDRLPDKNSSLDHPHCLSYKLELGS
DQEIPSDWYPFATIQFSMLGSCASRASVRSLGVESDVQPQKHVQQRACYNLQPKLYRSVI
EDVIEGVRDLFAEEGVEEQVLKDLKQLWETKVLQSKATEDFFRNSVHSPLFTLQLPHSLH
QTLQSTASLVIPAGRTLPGFITAELGSSNSSTNFTFPGYPIHVPAGVTLQTASGHLYKVN
VPIMVTQSSGRANIIQHPIQQVFQPLGQPSIIQTTVPRLNPCSLQATTEKSQRIETVLLQ
QPTVLHAGPIDRKHLENATSDTLVPTGSERKIMSEALLSQQESSQYISLAGVAFPLQVCQ
TNPNVEPVLSMTQNLHGGPLSAGPQGPLHQHMTDIQLHVLKNRMCGCDSVKQARNIEDSS
SLPVSEKDSNSQMDLSIQETDDDINEIIQIDGTGDTSSNEEIGSTKDVEENEFLGIIDTG
DLKVLEEEADSVSNEDSPANSSDNEDPKVARVEEDPLNSGDDVSEQDVPDLFDTDNVIVC
QYDKIHRSKNKWKFYLKDGVMCFGGRDYVFAKAIGDAEW
Download sequence
Identical sequences H0X5G6
ENSOGAP00000010519 ENSOGAP00000010519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]