SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010555 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010555
Domain Number 1 Region: 469-716
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.32e-60
Family Eukaryotic proteases 0.0000397
Further Details:      
 
Domain Number 2 Region: 376-469
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-34
Family Kringle modules 0.0000999
Further Details:      
 
Domain Number 3 Region: 190-274
Classification Level Classification E-value
Superfamily Kringle-like 2.15e-33
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 4 Region: 97-188
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-31
Family Kringle modules 0.00029
Further Details:      
 
Domain Number 5 Region: 287-370
Classification Level Classification E-value
Superfamily Kringle-like 8.46e-31
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 6 Region: 20-107
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 4.51e-16
Family Hairpin loop containing domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010555   Gene: ENSOGAG00000011794   Transcript: ENSOGAT00000011798
Sequence length 718
Comment pep:known_by_projection scaffold:OtoGar3:GL873698.1:1971205:1975873:-1 gene:ENSOGAG00000011794 transcript:ENSOGAT00000011798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLSLLLLLMQCSGVPGQRSPLNDFQVLRGTELQHLLHAVVPRPWQEDVADAEECAGRC
GSLLDCRAFHYNVSSHGCQLLPWTQNSPHTRLQHSGCCDLFQKKDYIRTCIMDNGVHYRG
TVATTASGLPCQSWSHKFPNDHKYTPTLRNGLEENFCRNPDGDPGGPWCYTTDPAVRFQS
CGIKACQEAACILCNGEDYRGAVDRTESGRECQRWDLQRPHQHPFEPRKFLDQGLDDNYC
RNPDGSERPWCYTTDPQIKREFCNLPRCGFDLPRSIQGSEAHPRHEATSLNCFRGKGEGY
RGTANTTASGVPCQRWDAQSPHQHRFVPEKYECKDLRDNFCRNPDGSEAPWCFTSRPSMR
VAFCYQIRRCVDDVRTEDCYHGTGEQYRGTVSKTRRGVQCQRWSAETPHRPQFTPTSAPH
AQLEENFCRNPDRDSHGPWCYTTDPGTPFDYCALRRCDDDHLPSILDPPDQVLFEKCGKR
VDRLDQFKLRVVGGQPGNSPWTVSLRNRKGQHFCGGSLVKEQWVVTARQCFSSCHMPLMG
YEVWLGTLFQDPQPGEPGLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQRVALICLPPER
YVVPPGTKCEITGWGETKNTGDGTVLKVALLNVISNQECNIKHRGRVRESEMCTKGLLAP
VGACEGDYGGPLACFTHDCWVLEGIIIPNRVCARPRWPAIFTRVSVFVDWIHKVMRLG
Download sequence
Identical sequences H0X5J0
ENSOGAP00000010555 ENSOGAP00000010555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]