SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010634 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010634
Domain Number 1 Region: 217-644,677-753
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 2.75e-195
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000178
Further Details:      
 
Domain Number 2 Region: 9-216
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 2.09e-69
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010634   Gene: ENSOGAG00000011886   Transcript: ENSOGAT00000011889
Sequence length 794
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:30961679:31010197:1 gene:ENSOGAG00000011886 transcript:ENSOGAT00000011889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHMVDSSDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDT
LAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLFNYINPHNGKHSPMVAK
STLDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGI
HQEDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQC
ALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFA
IYLEPWHADIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPG
LDEVWGEEFEKLYESYEKQGHVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQ
NLGTIKCSNLCTEVVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLNEVTKVIVRNLN
KIIDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYG
ALEASCDLAKEHGPYETYEGSPVSKGILQYDMWNVTPTDLWDWNLLKEKIAKYGIRNSLL
IAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWNEKMKNQ
IIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLTMAAERGAFIDQSQSLNIHIAEPNYG
KLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKLSKEEEEKERNTAAMV
CSLENRDECLMCGS
Download sequence
Identical sequences H0X5Q7
ENSOGAP00000010634 ENSOGAP00000010634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]