SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010661 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010661
Domain Number 1 Region: 5-249
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.22e-91
Family Carbonic anhydrase 0.00000000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010661   Gene: ENSOGAG00000011918   Transcript: ENSOGAT00000011920
Sequence length 258
Comment pep:known_by_projection scaffold:OtoGar3:GL873704.1:1486926:1510629:-1 gene:ENSOGAG00000011918 transcript:ENSOGAT00000011920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVHPLWTGLVPMSGGSQQSPINIQGKDSVYDPRLRPLQVSYTPTSCLHIWNTGYFFQVEF
DSTEGSGISGGPLENHYRLQQFHFHWGAENEWGSEHTVDGQVYPAELHLVHWNSVKYRNY
QEAVIGENGLAVIGVFLKLGAPHQALQKLVDILPEIKHKDARAAVGPFDPSCLLPTSRDY
WTYTGSLTTPPLAESVTWMIQKQPIEVSPSQLSAFRRLLFTAVGEKEKMMVNNYRPLQPL
LNRKVRASFPATTDDPKG
Download sequence
Identical sequences H0X5S9
ENSOGAP00000010661 ENSOGAP00000010661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]