SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010712 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010712
Domain Number 1 Region: 126-217
Classification Level Classification E-value
Superfamily POZ domain 8.37e-17
Family BTB/POZ domain 0.025
Further Details:      
 
Domain Number 2 Region: 271-343,370-396
Classification Level Classification E-value
Superfamily POZ domain 0.00000000322
Family BTB/POZ domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010712   Gene: ENSOGAG00000011971   Transcript: ENSOGAT00000011977
Sequence length 1133
Comment pep:known_by_projection scaffold:OtoGar3:GL873539.1:19159493:19220688:-1 gene:ENSOGAG00000011971 transcript:ENSOGAT00000011977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGANASNYPHSCSPRVGGNSQAQQTFIGTSSYSQQGYGCESKLYSLDHGHEKPQDKKKRT
SGLATLKKKFIKRRKSNRSADHAKQMRELLSGWDVRDVNALVEEYEGTSALKELSLQASL
ARPEARTLQKDMADLYEYKYCTDVDLIFQETCFPVHRAILAARCPFFKTLLSSSPEYGAE
IIMDINTAGIDMPMFSALLHYLYTGEFGMEDSRFQNVDILVQLSEEFGTPNSLDVDMRGL
FDYMCYYDVVLSFSSDSELVEAFGGNQNCLDEELKAHKAIISARSPFFRNLLQRRIRTGE
EITDRTLRTPTRIILDESIIPKKYAKVILHCMYTDVVDLSVLHCSPSVGSLSEVQALVAG
KPNMTRAEEAMELYHIALFLEFNMLAQGCEDIIAESISLDTLIAILKWSSHPYGSKWVHR
QALHFLCEEFSQVMTSDVFYELSKDHLLTAIQSDYLQASEQDILKYLIKWGENQLMKRIA
DREPNLLSGTAHSVNKRGVKRRDLDVEELREILSSLLPFVRIEHILPINSEVLSDAMKRG
LISTPPSDMLPTTEGGKSNAWLRQKNAGIYVRPRLFSPYVEEAKSVLDEMMVEQTDLVRL
RMVRMSNVPDTLYMVNNAVPQCCHMISHQQISSNQSSPPSVVANEIPVPRLLIMKDMVKR
LQELRHTEQVQRAYALNCGEGATVSYEIQIRVLREFGLADAAAELLQNPHKFFPDERFGD
ESPLLTMRQPGRCRINSTPPAETMFTDLDSFVAFHPPLPPPPPPYHPPATPIHNQLKASW
KQRPPSQHPSRSFSYPCNHSLFHSRTAPKPGPPPVYLPGIKAAPPDCTNTAGLGRQTVAA
AAAAPTSTTVASEKQVVSQMPRTQPVLNDLMPDIAVGVSTLSLKDRRLPELAVDTELSQS
VSEAVPGPPPHLSCIPQRHTHTSRKKHTLEQKTDARENQQEYPDFYDFSNAACRPSTPAP
GRRTPSPSQGGYFGPDLYSHNKASPSGLKSACLPSQTSPKKQEEARREYPLSPDGHLHRQ
KNEPIHLDVVEQPPQRSDLLSLGAPENAGTGPAHIRGRTTVETDLTFGLTPNRPSHSACS
SETPEERSSRRLADNESMGHGAQRNTDLEREDSVSRGRRSPSKPDFLYKKSAL
Download sequence
Identical sequences H0X5W4
ENSOGAP00000010712 ENSOGAP00000010712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]