SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010860 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010860
Domain Number 1 Region: 46-175
Classification Level Classification E-value
Superfamily POZ domain 6.28e-27
Family BTB/POZ domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010860   Gene: ENSOGAG00000012136   Transcript: ENSOGAT00000012139
Sequence length 482
Comment pep:known_by_projection scaffold:OtoGar3:GL873530.1:35190088:35247206:1 gene:ENSOGAG00000012136 transcript:ENSOGAT00000012139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLGPAAAEEQAAGTEAEPGAAGPPLPPSPSSLGPLLPLQREPLYNWQATKASLKERFA
FLFNSELLSDVRFVLGKGRGAAAAGGPQRIPAHRFVLAAGSAVFDAMFNGGMATTSAEIE
LPDVEPAAFLALLRFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLTKHLRADNA
FMLLTQARLFDEPQLASLCLDTIDKNTMDAISAEGFTDIDIDTLCAVLERDTLSIRESRL
FGAVVRWAEAECQRQQLPVTFGNKQKVLGKALSLIRFPLMTIEEFAAGPAQSGILSDREV
VNLFLHFTVNPKPRVEYIDRPRCCLRGKECCINRFQQVESRWGYSGTSDRIRFTVNRRIS
IVGFGLYGSIHGPTDYQVNIQIIEYEKKQTLGQNDTGFSCDGTANTFRVMFKEPIEILPN
VCYTACATLKGPDSHYGTKGLKKVVHETPAASKTVFFFFSSPGNNNGTSIEDGQIPEIIF
YT
Download sequence
Identical sequences H0X694
ENSOGAP00000010860 ENSOGAP00000010860 XP_003784646.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]