SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010928 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010928
Domain Number 1 Region: 1159-1430
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.26e-24
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 
Domain Number 2 Region: 1355-1644
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.04e-18
Family WD40-repeat 0.018
Further Details:      
 
Domain Number 3 Region: 977-1205
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-17
Family WD40-repeat 0.022
Further Details:      
 
Domain Number 4 Region: 394-634
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000019
Family Extended AAA-ATPase domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010928   Gene: ENSOGAG00000012215   Transcript: ENSOGAT00000012218
Sequence length 1742
Comment pep:known_by_projection scaffold:OtoGar3:GL873733.1:1075317:1261300:1 gene:ENSOGAG00000012215 transcript:ENSOGAT00000012218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPAGAGTKLPCPRDSALRRAAFSGNLTALPSHLVPAGRSVRVFISANPEDTGAERQALR
ENVYPKLREFCRENYGLEFQVIDLYWGVDEDDWDSPELQKARMKLLEDCLKTSAGPCFVG
LLGEKYGNIRIPGEVEASEFEMILDAAIEDKLETKLLEEWYCRDENAVPAAYYLRPRSEM
LRSNKNTMQPSANAENEKTWQEISDEIKKIFKAAVKLLHEKGKMKYSQAKRYLFSAIEDE
FDFALGKQTPAFLKKCVCYIRKIANIERFVKIPEMGKYMDITGTEPRIIRDPEAQEKLIK
LRDEFIPTIVASSNLRVYTSVTHCDMKLGYSQEIENHYIEGLGKQFYEDMIDIIQATVQQ
NFDTETDTLYDEILQHSSLCKTYASFYEYKCESLNIVHKYILPSKTGHINPLIVYGGPCT
GKTLLLAEVAKKAYGWLHEDTGPESDPVIVVRFLGTTDMSTDLRTLLLSVCEQLAINYRC
LVQSYPKKIHDLRDLFINLLNESSLQRPLVIIFDALEQLSENEEARKLWWLPAHLPRFVR
IVLSTLPNKHGILQKLRCLIHEEDNYIELIPRDRKMCSQVLKHQLLRVKRKVTSGQQIYV
NNAFSKCTLPMFVNLTFREVRHWRSHKDVDESSLCVTVHESIEQLFWSLEKKCGQKLVSR
ALGYITMAKMGLSEMELEDVLALDNSVMNELSENTRPSNPLRVPYLYIARLKEGLSGYLI
ERHVKNVTLLVWANRHLQLIAQKLYLQDDSHLREMHTILADYFLGVWSGGRRKAFCLEDS
YLNGCLDLESRSLLEEEKHFMEQASFDRQAPDQPWVFQCNPLEPDIFFVNHRKMSELLYH
LTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLSDIELAYNYSQEKELKFLASTLRGIR
NKVIAFPGSLSAELQQRLLPVISSLPKLRHLLLECDKDGPKYCSIVPLHSSMDVTYSPER
LPLSSSHLHVTEILPTCNPSTVLTALENGSISTWDVETRQLLRQITTAQSVILGMKLTGD
EKYLVVATTNNTLLIYDNVNSCLLSEVEIKGTKLASSPTYINGFTLSVKHALAWLEASKD
VTVIDLLYGWPLYQFHCWYEVTCVQCSLDGLYAFCGQYLNTTTIFHLGSGEKLCTVASEF
SGGFVKFLLILDTAQEMVMVDSEGSLSVWNTEDIASPQLTDDFDCRREDSDVVSIELSED
QSAILICKALSIELLDTGMWKVAEKFRAKHNERFISAVLSKNGDCIIATMENTSAVFFWR
RDTGQCMASLQEISGSIVKLVKSSHHNMLLSLSTSGVLSIWDIDIITAMSNIDKTGKPIQ
SLVLPARGEIIYSLDGSDCVHKWNFSSGFIEAVFKHEGIVEHCVLTSAGDIMVTSDDKSS
QYVWHTGSGENLFRINGQRISQLLITHNDQFVVSLCEENASRVWRLATGHRVCNILTTLQ
NAFITSANTFVVGMTKSKVLAVSLWTGSITKKFCCEDGTTIVNFKLIPDCPDIVVFITSA
ETVNLWSLTDEVICRRVQLPSNFLKNLEDFEISPNGKLGIISRGDENINVLDLHSGKLRV
VHASGTIWRQRLSRDGRYLVYICFRNGEEEDENGAISSLIVMRLADGKNIGACSLYKTPT
FLALSQRHLHIIVGFDDGSIGIYTVVDRVDAALKIKIATSNSRQIFNNATQTSRPKTNSY
CFKVSVDCLWRESTEVFARDSPITVTDCTENSEATPSKKYNSCYDRVCSALESRGHSYAP
DN
Download sequence
Identical sequences H0X6E8
ENSOGAP00000010928 XP_003801672.1.62490 ENSOGAP00000010928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]