SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010932 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010932
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily LEM domain 1.44e-22
Family LEM domain 0.000057
Further Details:      
 
Domain Number 2 Region: 108-155
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000000105
Family LEM domain 0.0000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010932   Gene: ENSOGAG00000012220   Transcript: ENSOGAT00000012223
Sequence length 691
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:21863171:21880427:-1 gene:ENSOGAG00000012220 transcript:ENSOGAT00000012223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGANSK
GPPDFSSDEEREPTPVLGSGTAAAGRSRAAVGRKATKKTDKPRLEDKDDLDVTELTNEDL
LDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDS
DRYSDNEEGKKKENKKVKSTRDFVPFSELPTTPSGGFFQGISFPEISTCPPLGSTELQAA
KKTHTSEGDPCRGPLIATDLPGRGQLQKVASGGNLFLSSKSSHGRCLEKSSSSSPQHELT
GMLVSTAASPSLIKETTTTCYKEMVENIYGGEKSGIQPLNPERSHFSYQSILSSERKAQE
ESERSQLISPPLAQAIRDYVNSLLVQGGVGSLPGTSNSTPPLDIESICKRIDQSKLRETE
SLSPPRKFRRLSEKSEVRDSGSFVTFQNITESELMSFAKSVVSHSLTTLGIEMSKESQYD
KIHASEPSFPLHESILKVIEEEWQQIDRQLPSLACKYPISSGEATRILSVPKVDDEILGF
ISEATPPASIQAATTESCDKQLDLALCRAYEAAASALQIATHTAFVAKAMQADISQAARI
LSSDPSRMQQALGILSKTYDAASYICDAAFDEVKISAHTMGNSTVGRRHLWLKECKLNSA
SKNKLAVTSFKGGTLFGGEVYKVIKKRGNKH
Download sequence
Identical sequences H0X6F2
ENSOGAP00000010932 ENSOGAP00000010932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]