SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000010980 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000010980
Domain Number 1 Region: 474-672
Classification Level Classification E-value
Superfamily Kelch motif 6.54e-62
Family Kelch motif 0.0000109
Further Details:      
 
Domain Number 2 Region: 629-759
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-39
Family Kelch motif 0.0000909
Further Details:      
 
Domain Number 3 Region: 206-321
Classification Level Classification E-value
Superfamily POZ domain 3.66e-30
Family BTB/POZ domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000010980   Gene: ENSOGAG00000012266   Transcript: ENSOGAT00000012276
Sequence length 761
Comment pep:known_by_projection scaffold:OtoGar3:GL873700.1:271405:316884:1 gene:ENSOGAG00000012266 transcript:ENSOGAT00000012276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRYIRKNVIYFPLNLFVVHSRAYTSLVLVGCTNLCAVLFARCLDDHLVSLRMSGSRKEF
DVKQILKIRWRWFGHQASSPNSTVDSQQGEFWNRGQTGANGGRKFLDPCSLQLPLASIGY
RRSSQLDFQSSPSWPMASTSEVPAFEFTAEDCGGAHWLDRPEVDDGTSEEENESDSSSCR
TSNSSHTSSCHTMEPCSSDEFFQALNHAEQTFKKMENYLRHKQLCDVILVAGDRRIPAHR
LVLSSVSDYFAAMFTNDVREARQEEIKMEGVEPNSLWSLIQYAYTGSRLELKEDNIECLL
STACLLQLSQVVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMEHFMEVIR
NQEFVLLPASEIAKLLASDDMNIPNEETILNALLTWVRHDLEQRRKDLSKLLAYIRLPLL
APQFLADMENNALFRDDIECQKLIMEAMKYHLLPERRPMLQSPRTKPRKSTVGTLFAVGG
MDSTKGATSIEKYDLRTNMWTPVATMNGRRLQFGVAVLDDKLYVVGGRDGLKTLNTVECY
NPKTKSWSVMPPMSTHRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQARQWNFVATM
STPRSTVGVAVLSGKLYAVGGRDGSSCLKSVECFDPHTNKWTLCAQMSKRRGGVGVTTWN
GLLYAIGGHDAPASNLTSRLSDCVERYDPKTDMWTAVASMSISRDAVGVCLLGDKLYAVG
GYDGQTYLNTVEAYDPQTNEWTQVAPLCLGRAGACVVTVKL
Download sequence
Identical sequences H0X6J2
ENSOGAP00000010980 ENSOGAP00000010980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]