SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011163 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011163
Domain Number 1 Region: 275-377
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.28e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 33-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000811
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 
Domain Number 3 Region: 119-186
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000183
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011163   Gene: ENSOGAG00000012464   Transcript: ENSOGAT00000012472
Sequence length 851
Comment pep:known_by_projection scaffold:OtoGar3:GL873602.1:8359922:8401248:-1 gene:ENSOGAG00000012464 transcript:ENSOGAT00000012472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKSRVSRNKSEKKRRDQFNVLIKELGS
MLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALD
GFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDS
LTPEYLKSKNQLEFRCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSTSAHNGFEGTIRR
THRPSYEDRICFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGY
LPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITY
HQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKE
ALERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHQKMAQRRPS
FSSQSINSQSVGSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEA
NIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQG
QVVPTNQVQSGMNTGHLGTTQHMLPQQTLQSTSTQQNQQNVLSGHGQQTSLPSQTQSALT
APLYNTMVISQPAAGSMVQIPSSVPQNSAQSAAVTSFTQDRQIRFSQGQQLVTKLVTAPV
ACGAVMVPSTMLMGQVVTAYPTFTTQQQQSQALSVTPPQQQQPPQSSQDPQLTTVPQPSQ
AQLTQPPQQFLQTSRLLHGNPSAQLILSAAFPLQQSTFPQSHHQQHQSQPQQQLSRHRTD
SLTDPSKVQPQ
Download sequence
Identical sequences H0X6Z8
ENSOGAP00000011163 ENSOGAP00000011163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]