SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011276 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011276
Domain Number 1 Region: 327-608
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-85
Family Kelch motif 0.0000000000306
Further Details:      
 
Domain Number 2 Region: 53-177
Classification Level Classification E-value
Superfamily POZ domain 6.8e-30
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011276   Gene: ENSOGAG00000012589   Transcript: ENSOGAT00000012591
Sequence length 624
Comment pep:known_by_projection scaffold:OtoGar3:GL873646.1:3578692:3587776:1 gene:ENSOGAG00000012589 transcript:ENSOGAT00000012591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPEPRPSGAGARSQFLPLKSQCPKGAGDTVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYEDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCTELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACINWVKYDCEQRRFYIQALLRAVRCHSLTPHFLQMQLQKCEILKSDSRCKDY
LVKIFQELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWRLVAPMLMRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTCMTSG
RSGVGVAVTMEPCRKQIDQQNCTC
Download sequence
Identical sequences H0X799
XP_003798009.1.62490 XP_012665670.1.62490 XP_012665671.1.62490 ENSOGAP00000011276 ENSOGAP00000011276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]