SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011287 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011287
Domain Number 1 Region: 8-486
Classification Level Classification E-value
Superfamily ALDH-like 7.33e-162
Family ALDH-like 0.0000000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011287   Gene: ENSOGAG00000012602   Transcript: ENSOGAT00000012603
Sequence length 487
Comment pep:known_by_projection scaffold:OtoGar3:GL873561.1:12655919:12683559:1 gene:ENSOGAG00000012602 transcript:ENSOGAT00000012603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTKELLMLENFIDGKFLPCNSYIDSYDPSTGEVYCRVPDSGKEEIDAAVQAARRAFPG
WSSRSPQERSQVLNKLADLLEQSLEELAQAESRDQGKTLTLARTMDIPRSVQNFRFFASS
VLHYTSECTQMDHLGCMHYTVRTPVGIAGLISPWNLPLYLLTWKIAPAIAAGNTVIAKPS
ELTSVTAWMLCKLLDKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSFANQGEICLCTSRIFVQKSIY
SEFLKRFVEATRKWKVSVPSDPSASMGALISKAHLEKVRNYVKKALTEGARIQCGEGVDE
LHLPARNQAGYFMLPTVITDIKDESCCMREEIFGPVTCVTPFHNEEEVIQRANNVKYGLA
ATVWSRDVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEI
KTITVKH
Download sequence
Identical sequences H0X7A8
XP_003790355.1.62490 ENSOGAP00000011287 ENSOGAP00000011287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]