SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011328 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011328
Domain Number 1 Region: 972-1174
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000586
Family WD40-repeat 0.021
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000011328
Domain Number - Region: 525-578
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00126
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011328   Gene: ENSOGAG00000012639   Transcript: ENSOGAT00000012647
Sequence length 1337
Comment pep:known_by_projection scaffold:OtoGar3:GL873563.1:7896677:7951708:1 gene:ENSOGAG00000012639 transcript:ENSOGAT00000012647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVV
NVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKK
ELQTQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIE
RSKMQQVGGNSQTESSLPGRSRKERPTSLNVFPLADGMVRAQMGGKLVPAGDHWHLSDLG
QLQSSSNYQCPQDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLNESLQPLGGYG
VGTKNSKRAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCPETRL
DRTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKE
VGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQTKVKLENRIKEL
EEELKRVKSEAIIARREPKEEVEDVSSYLCTELDKIPMAQRRRFTRVEMARVLMERNQYK
ERLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRSYPSVNIH
YKSPTTAGFSQRRSHAMCQISAGSRPLEFFPEDDCTSSARREQKREQYRQVREHVRNDDG
RLQACGWSLPAKYKQLSPSGAQEDTRMKNVPVPVYCRPLVEKDPTMKLWCAAGVNLSGWK
PLEDDPGNGVKPMPGRDPLTCDREVDDEPKSNHTSPEKKKAKELPETDATSSRVWILTST
LTTSKVVIIDANQPGTVVDQFTVCNAHVLCISSIPAASDNDYPPGEMFLDSDVNPEDPST
DGVLAGITLVGCATRCNVPRSNCSSREDTPVLDKEQGEVAAVANGKVNPSQSTEEATEAT
EVPDPGPSEPEAAAVRPGPLTEHVFTDPAPAPPSSTQPGSENGPDPDSSGVQPEPEPSGD
LAGAGSSAAPTMWLGAQNGWLYVHSAVADWKKCLHSIKLKDSVLSLVHVKGRVLVALADG
TLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVYDRVWCGYKNKIHVIQPKTMQIEK
SFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGK
LGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGAR
PGGVIHVYGDDSSDKSASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLD
SPSESPGPAAPTSDAESRKLKNVLVLSGGEGYIDFRIGDGEDDETEEGSGDVSQVKPVLS
KAERSHIIVWQVSYTPE
Download sequence
Identical sequences H0X7E4
ENSOGAP00000011328 ENSOGAP00000011328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]