SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011339 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011339
Domain Number 1 Region: 57-158
Classification Level Classification E-value
Superfamily POZ domain 5.89e-29
Family Tetramerization domain of potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011339   Gene: ENSOGAG00000012657   Transcript: ENSOGAT00000012658
Sequence length 283
Comment pep:known_by_projection scaffold:OtoGar3:GL873654.1:5092392:5102847:1 gene:ENSOGAG00000012657 transcript:ENSOGAT00000012658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHRKERPSGSSLHAHGSPGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHI
DVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTS
KLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGER
IALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQVLERLFQRG
FSVAASCGGGVDSSQFSEYVLCREERRPQPTPTAVRIKQEPLD
Download sequence
Identical sequences H0X7F3
XP_003798489.2.62490 ENSOGAP00000011339 ENSOGAP00000011339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]