SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011358 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011358
Domain Number 1 Region: 92-202
Classification Level Classification E-value
Superfamily Ribosome-binding factor A, RbfA 1.09e-24
Family Ribosome-binding factor A, RbfA 0.00000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011358   Gene: ENSOGAG00000012673   Transcript: ENSOGAT00000012678
Sequence length 338
Comment pep:known_by_projection scaffold:OtoGar3:GL873546.1:183643:195542:-1 gene:ENSOGAG00000012673 transcript:ENSOGAT00000012678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLTGRLWSPHAGLWALLRTCNAALLPGRARDLHGSSVSCGSKNLLKKFASKSKKKFWY
DGPSLGSHLTYTPSPSKFEFLMKNTSKKARKEDQVRLRTLNGLLHKALTDLLCTPEVSQE
VYDLRVELSKVSLTSDFSACRVYWKTTLSAEQNSQTQATLQRSAAHMRHLLMSQQTLKNM
PPIVFVQDKENAAQVEIDHLLAIADFGPQEGEHFVQNDFRDPDAPPLCGTAEPAAQSSLY
GIDHEALNKQIAEYKRRKESRQWHTAGPGTVAELAKQMIKKKAKPRGDQDSSLRSYLAGG
DDLDDAPGYKCHLHDSEEWEAERGGSTDQGRCWGAREE
Download sequence
Identical sequences H0X7H1
XP_003788493.1.62490 ENSOGAP00000011358 ENSOGAP00000011358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]