SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011366 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011366
Domain Number 1 Region: 14-112
Classification Level Classification E-value
Superfamily DNA clamp 0.000000722
Family DNA polymerase processivity factor 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011366   Gene: ENSOGAG00000012683   Transcript: ENSOGAT00000012687
Sequence length 280
Comment pep:known_by_projection scaffold:OtoGar3:GL873642.1:3639027:3654555:1 gene:ENSOGAG00000012683 transcript:ENSOGAT00000012687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFRGKIVDGACLNHFTRVSNMIAKLAKTCTLRISPDKLNFILSDKLTSGGVSMWCELEQ
ENFFSEFQMEGVSAENNEIYVELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVDLL
SVSSSSRIVTHDIPIKVIPRKLWKDLQEPVVPHPDVSIYLPVLKTMKSVVEKMKNISNHL
VIEANLNGELNLKIETELVCVTTHFKDLGNPSLASENASQDRNPEQMAEVHLDIKKLLQF
LVGQQVNPTKALCNIVRNKMVHFDLLHEDVSLQYFIPALS
Download sequence
Identical sequences H0X7H9
ENSOGAP00000011366 ENSOGAP00000011366 XP_003797797.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]