SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011487 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011487
Domain Number 1 Region: 7-127
Classification Level Classification E-value
Superfamily POZ domain 2.41e-26
Family BTB/POZ domain 0.00041
Further Details:      
 
Domain Number 2 Region: 522-582
Classification Level Classification E-value
Superfamily A DNA-binding domain in eukaryotic transcription factors 6.8e-21
Family A DNA-binding domain in eukaryotic transcription factors 0.0013
Further Details:      
 
Domain Number 3 Region: 568-611
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00000141
Family Leucine zipper domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011487   Gene: ENSOGAG00000012819   Transcript: ENSOGAT00000012822
Sequence length 739
Comment pep:known_by_projection scaffold:OtoGar3:GL873630.1:6190317:6210846:-1 gene:ENSOGAG00000012819 transcript:ENSOGAT00000012822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSENSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTVFVEGHRFRAHRSVLAACSSYFH
SRVVGQADAELNITLPEEVTVKGFEPLIQFAYTAKLILSKDNVDEVCKCVEFLSVHNIEE
SCFQFLKFKFLESTANQPEWSRKKCFPSHCQKTDLKFSLLDKRDLEIDEVKEFLENKNVQ
TPQYKLCVSPGNAKVSPPLQDSASQTCESMCFEKDAALTLPSLCPKYRKFQKAFGTDRVR
TVESSVKDARTSLQPNETPESECPGGALECVDLQVALKCEESKLTMDPEETKKKDPVSQC
PTEKTEETPFPYGSSTDPHGLYSLSLLTYDQYGDLNFANMQNTAVITEKPLSGTDIQDEK
TFGESQDLHLKSDSGPREDSSLASGDRSSVEREVAEHLAKGFWSDICSTDSPCQAQLSPA
VAKDGSEQSYSQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEACSSNLEI
GNDDYVSEPQQEPCPYTCVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIISLSR
NDFQSLLKMHKLTPEQLDCIHDIRRRSKNRIAAQRCRKRKLDCIQNLESEIEKLQNEKES
LLKERDHILSTLGETKQNLTGLCQQVCKEAALSQEQIQILAKYSASDCPLSFLISEKEKN
TPRGELALPSIFSLSNGPPAVLPPCARGEGESCCAERQESQPPPPPATSEQAGLGQQCRQ
SGGISDFCQQMTDKCTTDE
Download sequence
Identical sequences H0X7S9
ENSOGAP00000011487 ENSOGAP00000011487 XP_003797132.1.62490 XP_003797133.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]