SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011489 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011489
Domain Number 1 Region: 18-112
Classification Level Classification E-value
Superfamily POZ domain 2.71e-32
Family BTB/POZ domain 0.00000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011489   Gene: ENSOGAG00000025859   Transcript: ENSOGAT00000012824
Sequence length 112
Comment pep:novel scaffold:OtoGar3:GL873545.1:5003752:5004090:-1 gene:ENSOGAG00000025859 transcript:ENSOGAT00000012824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGEEKTYGGCEGPDAMYVKLIPSDGHELIVKREHALTSGTIKAMVSGPGQFAENETNEV
SFRESPSHVLSKVCMYFTYKVRYTNSSPESPEFPIAPEIVLELLMAANFLDC
Download sequence
Identical sequences H0X7T1
ENSOGAP00000011489 ENSOGAP00000011489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]