SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011506 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000011506
Domain Number - Region: 259-296
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0667
Family RILP dimerisation region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011506   Gene: ENSOGAG00000012837   Transcript: ENSOGAT00000012841
Sequence length 442
Comment pep:known_by_projection scaffold:OtoGar3:GL873571.1:1517057:1769738:-1 gene:ENSOGAG00000012837 transcript:ENSOGAT00000012841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENWSKDTTHSYLEHDTIGRNKHTQPDEQLTMNSEESIHQKSNELLHEDTYEGTELPGQR
SGNFHVISPYPDDETAYCTTENSNIIEPGSNDLHYEYMMSCQVTSDLSKEKTIAFLLKEL
DILRTSNKKLQEKLTNKDKEQRKLKFKLDLQEKTTEAKIAEKTAALVEEVYFAQRERDEA
IMSRLQLAIKERDEAIAQAKHMEMSLKVLENINPEENDMTLQELLNRINNADTGIAIQKN
GAIIVDRIYKTKECKKRITAEEMSAVIQERDAALSQCKRLEQELHHLKEQNQTSANNMRH
LTAENNRERALKAKLLSMQQARETAVEQYKKLEEEIQTLRVYYSLHNSLSQEENLKEQFN
HTLTTYEEALKNREVIVSITQQQNEELAAQLHQALTEKANMELQLQEAVKASQVASEKVQ
KLERLVEVLRKKVGTGTMRTVI
Download sequence
Identical sequences H0X7U3
ENSOGAP00000011506 ENSOGAP00000011506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]