SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011741 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011741
Domain Number 1 Region: 28-215
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000889
Family Quinoprotein alcohol dehydrogenase-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011741   Gene: ENSOGAG00000013103   Transcript: ENSOGAT00000013108
Sequence length 993
Comment pep:known_by_projection scaffold:OtoGar3:GL873528.1:5622303:5652611:1 gene:ENSOGAG00000013103 transcript:ENSOGAT00000013108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALASGFCLWAALLFPAVAVYEDQVGKFDWRQQYVGKLKFASLEFSPGFKKLVVATEK
NVIAALNSRTGEICDSEGDDRTGLGNDFTLVLFFPDAITVSNGGRIMRSWETNIGGLNWE
ITLDSGSFQALGLVGLQESVRYVAVLKKTTLALHHLSSGHLKWVEHLPESDSIHYQMVYS
YGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQRLAGACGVVDEAVLVCPDP
SSRSLQTLALETEWELRQIPLQSLDLEFGSGFQPRILPTQPNPVDPSRAQFFLQLSPNHY
ALLHYHHGVLSLLKNFPQTALVSFATTGEKTVAAVMTCRNEVQKPSHSEDGSLGSFSEKS
SPKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVGYR
ALVQTEDHLLLFLQQLAGKTVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGL
LGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVT
ASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKETGMSS
LYVFNPIFGKWSQVAPPVLKRPILQSLLLPIMDQDYAKVLLLIDDEYKVTAFPATRNVLR
QLHELAPSIFFYLVDAEQGRLSGYRLRKDLTTELSWELTIPPEVQRIVTVKGKRSSEHVH
SQGRVMGDRSVLYKSLNPNLLAVVTESTDVHHERTFIGIFLIDGITGRIVHSSVQKKAKG
PVHIVHSENWVVYQYWNTKARRNEFTALELYEGTEQYNATAFSSLDRPQLPQVLQQSYIF
PSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSP
DVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDY
DYVLISSVLFGLVFATMITKRLAQVKLLNRAWR
Download sequence
Identical sequences H0X8D6
ENSOGAP00000011741 ENSOGAP00000011741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]