SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011858 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000011858
Domain Number - Region: 388-471
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0317
Family PYP-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011858   Gene: ENSOGAG00000013233   Transcript: ENSOGAT00000013238
Sequence length 822
Comment pep:known_by_projection scaffold:OtoGar3:GL873563.1:3660003:3792231:-1 gene:ENSOGAG00000013233 transcript:ENSOGAT00000013238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQDGYFSHRPKEKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPELAKKPPSRQKEL
LKRKLELQEKGKGPNEALPPGERAAANSSRGKDAPRQPHARKSGGSSPETKYDQPPKCDI
SGKEAISALSRAKSKHCRQEIGETYCRHKLGLLMPEKVTRFCPLEGKANKNVQWDEDSVE
YMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKEKRSNYLHRQVLQFARQ
YGNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRTNDQLVA
FLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRRIPEGIAVDGGSDWFL
LNRKFVEYVTFSTDDLVTKMKQFYTYTLLPAESFFHTVLENSPHCDTMVDNNLRITNWNR
KLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKFEAVVNQEIIGQLDYYLY
GNYPAGTPGLRSYWENVYDEPDGTHSLSDVTLTLYHSFARLGLRRAEASLHTDGENSCRY
YSMGHPASVHLYFLADRFQGFLVKHHATNLAVSKLETLETWVMPKKVFKIASPPSDFGRL
QFSEVGTDWDAKERLFRNFGGLLGPMDEPVGMQKWGKGPNVTVTVIWVDPVNIIAATYDI
LIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVAPLTFSNRQPIKPEEASK
LHNGPPRSAYMEQSFQSLNPVLSLPISPAQVEQARRNAASTGAALEGWLDSLVGGMWTAM
DICTTGPTACPVMQTCSQTAWSSFSPDPKSELGAVKPDGRLR
Download sequence
Identical sequences H0X8M9
ENSOGAP00000011858 ENSOGAP00000011858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]