SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011885 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011885
Domain Number 1 Region: 3-368
Classification Level Classification E-value
Superfamily ARM repeat 3.96e-34
Family Armadillo repeat 0.042
Further Details:      
 
Domain Number 2 Region: 668-720
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000343
Family Homeodomain 0.00069
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000011885
Domain Number - Region: 391-453
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00817
Family VPS28 N-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011885   Gene: ENSOGAG00000013265   Transcript: ENSOGAT00000013267
Sequence length 727
Comment pep:known_by_projection scaffold:OtoGar3:GL873670.1:2252809:2300029:1 gene:ENSOGAG00000013265 transcript:ENSOGAT00000013267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESEDTKKIQEMKTDLNLLLECLKYQMDNPFSQKEALVTIHSICQQNNNAGIYFREIGGL
TFIKNLAKSSEHSVVKEAALYALGGIAEKDVYCQQTLCTSELFEDLTCFLSNESNTNLKR
VSVYVVLVLVSNNRMGQTLVRETGCITVLSQLFRTVLSKYELNLSDKNVFQNYQLWSSVC
STLCVCVNNPQNDENQKFCCSLFSYANEWLINCMEPEIIRPICSFIGLTLANNISVQKYF
LSVGGLDILAQVFVQLVSDSHKTLSSAKLAVMVTKTVDACIADNPTFGIVLFKYQIVPKL
LTLLLHESLDSGEKFSIILTLGHCTEDCEENQYDLFKYNGLPLMIQALTDSQDEELNKAA
IFVLHNCQRAAEKLSLSLGDYSFDENETEQSNYMNMKEKKLEEHWKKAKEILHRIEQLER
EENEEKIKREKYMDNILSRNINLQNTLKHLHTDSTGQGTKGGDKSKSHCRQIQSYKSHRV
MSQASSDDQMKTLLKDANPVNACYIEDEKNKTLFKANSSCNQNSHEETALEQNNFVSQSS
DHVFKHPTHTAKNRKQQLPVTDPFTLCSDIINKEVIGFLATEDCSKMLKYRCSGCIAVGK
SLNSRNFSKLLHSCQYQCDRHKVIVEAEDKYKSELRKSLICNKKILLTPRRRQRLSNESI
TPGEIKKRRIRKNFTKEEVNYLYNGVKKMGNHWNSILWSFPFQQGRTAVDLARKYQKLTK
YPKCGAS
Download sequence
Identical sequences H0X8Q2
XP_003799470.1.62490 ENSOGAP00000011885 ENSOGAP00000011885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]