SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011995 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011995
Domain Number 1 Region: 91-135
Classification Level Classification E-value
Superfamily LysM domain 0.0000000103
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011995   Gene: ENSOGAG00000013388   Transcript: ENSOGAT00000013391
Sequence length 843
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:20774400:20870236:-1 gene:ENSOGAG00000013388 transcript:ENSOGAT00000013391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYLTTFTGKSGRLLRGTANRLWGFRAGGEARQVRFEDYLREPAQGDPGCGSPPHRPPAP
SSPEGPDTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNK
LFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSEAEFDKTTNPDVVHLKEATP
PSTFTSTSIRPTRVVSSTSEEEEAFTEKFLKINCKYITSGKGTVSGVLLVTPNNIMFDPH
KTDPLVQENGCEEYGIMCPMEEVMSAAMYREILDSKVKESLPIEIDQLSGKGFCHSKKMT
GSNTEDIDSRTRDAGNDSASTAPRSTEESLSEDVFTESELSPIREELISSDELRQDKSSG
ASSESVQTVSQTETERLTIKSGSPSTPGHLKSDAEHSTNEIETLSHKTDLSNLGVTTNER
EQIIDNFQEISGPKEQSSSVQGNADQDFLLGENSLHHEESENQNTSCEETAELKQKQTVS
KGKQGKDQSRDSETEVEELRKLWKTHTMQQTKQQRENMQQVSQKDIKHKIASADGHVEGS
VLLKEKRRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLY
AFFIQWSPEIYAEDTGECTREPGFIIVKKIEESETNEDSSDQAAAREWEITTREDINSKQ
VAPVKAELESECFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKT
LYRTMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFKWTG
DNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNHTLSKKEDFFIQDIEIW
AFE
Download sequence
Identical sequences H0X8Z8
XP_003782463.1.62490 ENSOGAP00000011995 ENSOGAP00000011995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]