SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012236 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012236
Domain Number 1 Region: 434-884,913-1008
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.98e-135
Family alpha-mannosidase, C-terminal domain 0.0000652
Further Details:      
 
Domain Number 2 Region: 25-351
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.45e-102
Family alpha-mannosidase 0.00000829
Further Details:      
 
Domain Number 3 Region: 356-455
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 5.56e-27
Family alpha-mannosidase, domain 2 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012236   Gene: ENSOGAG00000013656   Transcript: ENSOGAT00000013665
Sequence length 1011
Comment pep:known_by_projection scaffold:OtoGar3:GL873690.1:3504843:3539540:1 gene:ENSOGAG00000013656 transcript:ENSOGAT00000013665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLHCLLLLLHLLVLRQPGAQAAGPIRAFVVPHSHMDVGWVYTVQESMRAYAANVYTSV
VEELTRGQQRRFISVEQEFFRLWWDSVASDQQKHQVRHLVDEGQLEFVIGGQVMHDEAVT
HFDDQILQLTEGHGFLYETFGIRPQFSWHVDPFGASATTPTLFALAGFNAHLISRIDYDL
KEARQEARELQFVWRGSPSLWTQQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNGVAVFPE
PPPDGVYPNMSEPVTPANIDLYAEALAANVKQRAAWFQTPHVLWPWGCDKQFFNASVQFS
NMDQLLDHINSHADKLGVSVQYATLGDYFRTLHALNVTWRIQDHQDFLPYSTEPFQAWTG
FYTSRSALKGLARRASAFLYAGESMFTRYMWPAPHGPLDLAWALQQLQQLRWAVSEVQHH
DAITGTESPKVRDMYLEHLAFGMQGVGKLMAAIVLDRPQPGAGRATPSADSGARPTGHSV
AVYNPLAWTITTIVTLTIGFPRVSVTDELGHPVPAQVQNSTKTPSAYTLHILTTIPGLSY
RYYSVRPTAGAQEPVATVASTLQFGRRPRRRDSRGRRRLVPVENDCYTVLLDEDTNLMHS
VQERQSNRRVKVTQEFLEYHVNGDLKQGPISDNYMFTSKEPAVPAWEAVGMEIVVGTLVT
EIRQYFYRNVTAQDYTYVIYSRLAHVPQGQDGELLCHRIEQEYQVGPLELNREAVLRTST
DLDSQQVLYTDNNGYQMQRRPYRAYTNNSIARNYYPMVQSAFIEDSRSRLVLLSERAHGI
SSQGNGQVEVMLHRRLWNNLDWNLGYNLTLNDTSVVHPILWLLLGPWSVTTALRQRSGLA
LQHRPIVLFGELAGTAPKPPKSWKQEAVMLPPNLHLQILSIPGWNYSSNHTEHVQNLRKA
LKGHQGKTQADLHRVLLRLHHLYEADEDPVLSQPVTVDLEAMLRGLGPMAAVEERSLTGT
WDVNTLRRWSWMTEPGHHRGLGRSPSGPPGGLTITVHPKEIRTFFVYFRQQ
Download sequence
Identical sequences H0X9J5
ENSOGAP00000012236 ENSOGAP00000012236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]