SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012257 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012257
Domain Number 1 Region: 399-437,475-579,693-808
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-51
Family Phosphate binding protein-like 0.0000881
Further Details:      
 
Domain Number 2 Region: 34-374
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000155
Family L-arabinose binding protein-like 0.012
Further Details:      
 
Domain Number 3 Region: 288-389
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000565
Family L-arabinose binding protein-like 0.013
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000012257
Domain Number - Region: 571-669
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00141
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012257   Gene: ENSOGAG00000013685   Transcript: ENSOGAT00000013688
Sequence length 1044
Comment pep:known_by_projection scaffold:OtoGar3:GL873548.1:13710321:13719602:1 gene:ENSOGAG00000013685 transcript:ENSOGAT00000013688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFVRVLWLGLVLGLGPGPVGGHPQPCGVLERLGGSVRLGALLPRAPGARARALTALTRA
ILAPRLPHNLSLELVAMKTPARDPASLTHSLCQALAPPGVAALLAFPEARPELLQLHFLA
AATETPVLSVLRREARAPLGSPNLFHLQLDWASPLETLLDVLVSVLRAHAWEDIGLVLCR
VRDPSGLVALWTSRAGQAPQLVLDLSRLNTRDTELQAHLAPLSLPVGGEALVSVAVLLGC
DAPHARQVLEAVPPGPRWLLGTPLPADALPTEGLPLGLLALGEVARPPLEAAIYDAVDLV
AQALDRAAQVQPERALLPTTVNCSSLQPTRPESSGRFLARFLANTSFQGQTGPVRVTTTS
QVLISRHFKVWSLRRDPHGAPAWATVRSWQDGQLDLEAGGAAVRPPPLQGAQAPPKLRVV
TLVEHPFVFAREPDEDGQCPAGQLCLDPRTNDSATLDTLFAALANGSVPHSLRKCCYGYC
IDLLEQLAEDTPFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQ
VVDFTSPFFSTSLGILVRARDTASPIGAFMWPLHWSMWVGVFSALHLTALFLTLYEWRSP
YGLTPRGRNRSTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSY
TANLAAVMVGDKTFEALSGIHDPKLHHPSQGFRFGTVWESSAEAYIKKSFPEMHGHMRHH
SAPTTPLGVAMLTSDPPKLNAFIMDKSLLDYEVSIDTDCKLLTVGKPFAIEGYGIGLPRN
SPLTSNLSEFISRYKSSGFIDLLHDKWYKMVPCGKRVFAVTETLQMGIYHFSGLFVLLCL
GLSSALLSSLGEHVFYRLALPRIRRGNKLQYWLHTSQKIHHALNPEPPDAQESPRPETSP
PALGLEEQERQDTSTAQEGSGACKQVCQAIGKERRVRFLLEPPAAATPENTAVETRTPEG
PMWLCSNGRTPSVLAQGPPQPNELQKLEQHIEGVRERLRQALIRRGDLLAQLRDSAQHRP
LRLLPARAAPGEAPSYLGPWGNKE
Download sequence
Identical sequences H0X9L2
ENSOGAP00000012257 ENSOGAP00000012257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]