SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012281 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012281
Domain Number 1 Region: 70-121
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000752
Family VPS37 C-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012281   Gene: ENSOGAG00000013709   Transcript: ENSOGAT00000013712
Sequence length 250
Comment pep:known_by_projection scaffold:OtoGar3:GL873618.1:3285590:3287492:-1 gene:ENSOGAG00000013709 transcript:ENSOGAT00000013712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTQNIQLNKEMTLASNRSLAEGNLLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDK
QSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKI
EKLQEMVLKGQRLPQAPALLPPRVPEPVSAAAALPYPAPEASGPPSVVPRRIPPPPPLVP
AGRLATPFTAAMGSGQAMPYPGLQCPPLPPRVGLPPQQGFSAQFVSPFPPALPQRPPPRL
PPHQPGFILQ
Download sequence
Identical sequences H0X9N1
ENSOGAP00000012281 ENSOGAP00000012281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]