SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012313 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012313
Domain Number 1 Region: 71-116
Classification Level Classification E-value
Superfamily LysM domain 0.00000000107
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012313   Gene: ENSOGAG00000013741   Transcript: ENSOGAT00000013745
Sequence length 215
Comment pep:known_by_projection scaffold:OtoGar3:GL873530.1:4497145:4513654:-1 gene:ENSOGAG00000013741 transcript:ENSOGAT00000013745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSSPALSLREGGSRAPRPAAHSPPPRSRSGSESEEAELSLSLARTKTRSYGSTASVRA
PLGAGVIERHVEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPIISE
KPLLFNGLNSIDSPENETVDSSFPPEEDPVVAREDLPPPSPQEPEVQPVQPEEVSARDFL
QRLDLQIKLSTQAAKKLKEESRDEENPYATSLYHS
Download sequence
Identical sequences H0X9Q7
ENSOGAP00000012313 ENSOGAP00000012313 XP_012657304.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]