SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012418 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012418
Domain Number 1 Region: 126-210
Classification Level Classification E-value
Superfamily Tetraspanin 0.0000000000863
Family Tetraspanin 0.014
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000012418
Domain Number - Region: 6-75
Classification Level Classification E-value
Superfamily dUTPase-like 0.0608
Family dUTPase-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012418   Gene: ENSOGAG00000013866   Transcript: ENSOGAT00000013868
Sequence length 229
Comment pep:known_by_projection scaffold:OtoGar3:GL873646.1:2747286:2764426:-1 gene:ENSOGAG00000013866 transcript:ENSOGAT00000013868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEMHTPYSSLKKLLPLFNVFLAVSGIILIGLGISIKCGDGALTRVFGLSSAYFLHISNL
CMVMGCILILLSCTGCYGTAKNSRGTLLFCFIVMVIILVVEITAATVVLLFFPVVKDLAL
EHSFMTLRKNYRGYNEPDEYSTEWNLVMEKLKCCGVNNYTDFSGSYFEMTTGHTYPRGCC
KSIGTTACDGHNVSPQVIRQQGCFRKLLKITKTQSYTLCGVSLGAAVIQ
Download sequence
Identical sequences H0X9Z6
ENSOGAP00000012418 ENSOGAP00000012418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]