SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012501 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012501
Domain Number 1 Region: 17-229
Classification Level Classification E-value
Superfamily PHP domain-like 8.24e-46
Family RNase P subunit p30 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012501   Gene: ENSOGAG00000013963   Transcript: ENSOGAT00000013967
Sequence length 268
Comment pep:known_by_projection scaffold:OtoGar3:GL873527.1:36254890:36284532:1 gene:ENSOGAG00000013963 transcript:ENSOGAT00000013967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFADLDLRASSDLKTLRELVENAAHLGYSVVAINHVVDFKEKKQEIEKPVAVSELFTT
LPVVQGKSRPIKILTRLTIIVSDPSHCNVLRATSSRVRLYDIVAVFPKTEKLFHVACTHL
DVDLVCITVTEKLPFYFKRPPINVAIDRGLGFELAYSPAIKDSTMRRYTISNALNLMQIC
KGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFG
IISTVKKPRPSEGDDDSFPACKKAKCEG
Download sequence
Identical sequences H0XA70
ENSOGAP00000012501 ENSOGAP00000012501 XP_003783741.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]