SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012509 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012509
Domain Number 1 Region: 347-542
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.05e-43
Family Pyruvate oxidase and decarboxylase PP module 0.00000952
Further Details:      
 
Domain Number 2 Region: 174-334
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.01e-41
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000954
Further Details:      
 
Domain Number 3 Region: 14-159
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.91e-31
Family Pyruvate oxidase and decarboxylase Pyr module 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012509   Gene: ENSOGAG00000013969   Transcript: ENSOGAT00000013975
Sequence length 554
Comment pep:known_by_projection scaffold:OtoGar3:GL873521.1:33006782:33044616:-1 gene:ENSOGAG00000013969 transcript:ENSOGAT00000013975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEHTLAEPSDGSEEQVSGAKVIAQALKTQGVEYVFGIVGIPVTEIAVAAQELGIRYIGM
RNEQAASYAASAIGYLTGRPLLVIAGSSERNQETMGAFQEFPQVEACRLYSKFSARPSSI
EAIPSVIEKAVRSSIYGRPGACYVDIPADFVNLLVNVNSIKYTECCMSPPVSMAETAAVC
EAASFIRNAKQPLLIIGKGAAYAHAEENIRKLVDQCKLPFLPTPMGKGVIPDNHPNCVGA
ARSRALQFADVIVLFGARLNWILHFGLPPRYQPDVKFIQVDICAEELGNNVRPAVTLLGD
INAVSKQLLEEFYKTPWQYPPESKWWKILREKMKSNEAASKELASQNSLPMNYYTVFYHI
QEQLPRDCFIVSEGANTMDIGRTVLQNYLPRHRLDAGTFGTMGVGLGFAIAAAILAKDRS
PGQRVICVEGDSAFGFSGMEVETICRYNLPIILLVVNNNGIYQGFDTDTWKEMLKSQDAT
TVAPPMCLLPNSHYEQVMTAFGGKGYFVQTPEELQKSLRQTLADTTKPSLINIMIEPQAT
RKSQDFHWLTRSSM
Download sequence
Identical sequences H0XA77
ENSOGAP00000012509 XP_003781767.1.62490 ENSOGAP00000012509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]