SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012555 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012555
Domain Number 1 Region: 51-214
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.07e-45
Family Pyruvate oxidase and decarboxylase Pyr module 0.00012
Further Details:      
 
Domain Number 2 Region: 445-627
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.23e-43
Family Pyruvate oxidase and decarboxylase PP module 0.0013
Further Details:      
 
Domain Number 3 Region: 203-213,265-430
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.87e-28
Family Pyruvate oxidase and decarboxylase, middle domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012555   Gene: ENSOGAG00000014020   Transcript: ENSOGAT00000014025
Sequence length 632
Comment pep:known_by_projection scaffold:OtoGar3:GL873624.1:366848:374291:-1 gene:ENSOGAG00000014020 transcript:ENSOGAT00000014025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METFMAAAPAGSCFSSFLLLACGTLVAALLGAAHCLGLFYQLMHKVDKASVRHGGENVAA
VLRAHGVRFLFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAVGRLTGVVGVAAV
TAGPGLTNTVTAVKNAQMSQSPVLLLGGAAPTLMQNRGALQAIDQMSLFRPLCKFCASVR
RVRDIVPTLRAAIAAAQSGTPGPVFVELPVDVLYPYFIIQKEMMPATVPKGLMGRGVFWY
LENYLANLFAGAWEPQPEGPLPLDIPQASPQQVQRCVELLSRAKRPLILLGSQALLSPTS
ADKLRAAVETLGVPCFLAGMARGLLGRNHPLHIRENRSAALKKADVIVLAGIVCDFRLSY
GRVLSRNSKIVIVNRNRKEMLLNSDIFWKPQEAVQGDVGSFMLKLVEGLQGQTWAPDWAE
ELKEADRQKQQAFQEKAAMPMTQHLNPIQVLQLVEETLPDNSVLVVDGGDFVGSASHLIQ
PRGPLCWLDPGAFGTLGVGAGFALGAKLSRPDAEVWCLFGDGAFGYSLIEFDTFVRHKIP
VIALVGNDAGWTQISREQVPCLGSNVACGLAHTDYHKAAMGLGARGLLLSQDNKDQVVKV
LRDAQQQCRDGHPVVVNILIGRTDFRDGSISV
Download sequence
Identical sequences H0XAB9
ENSOGAP00000012555 ENSOGAP00000012555 XP_003796551.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]