SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012635 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012635
Domain Number 1 Region: 42-197
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 3.14e-83
Family Hedgehog (development protein), N-terminal signaling domain 0.000000076
Further Details:      
 
Domain Number 2 Region: 202-348
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.83e-41
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012635   Gene: ENSOGAG00000014108   Transcript: ENSOGAT00000014110
Sequence length 410
Comment pep:known_by_projection scaffold:OtoGar3:GL873532.1:13350065:13355481:1 gene:ENSOGAG00000014108 transcript:ENSOGAT00000014110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPARLRPRLRFCLLLLLLVVPAARGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTL
GASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQ
WPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYE
SKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLESGARVALSALQLGDRVLAMGEDGNPTFS
DVLIFLDREPNKLRAFQVIETRDPPRRLTLTPAHLLFTADNHTEPAAHFRATFASHVQPG
QYVLVAGVPGLQPARVAAVSTHVALGAYAPLTRHGTLVVEDVVASCFAAVADHHLAQLAF
WPLRLFHSLAWGSWPLGEGVHWYPQLLYRLGHLLLEEGSFHPLGMSGTGS
Download sequence
Identical sequences H0XAI6
ENSOGAP00000012635 XP_003784988.1.62490 ENSOGAP00000012635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]