SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012741 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012741
Domain Number 1 Region: 14-496
Classification Level Classification E-value
Superfamily ALDH-like 1.31e-186
Family ALDH-like 0.0000000000000399
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012741   Gene: ENSOGAG00000014218   Transcript: ENSOGAT00000014221
Sequence length 501
Comment pep:novel scaffold:OtoGar3:GL873525.1:30881210:30935284:-1 gene:ENSOGAG00000014218 transcript:ENSOGAT00000014221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSGMPDLPAPLANLKIQYTKIFINNEWHDSASGKKFPVFNPATEEIICHVEEGDKEDV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMEAMNGGKLFSNAYL
MDLGGCIKTLRYCAGWADKVQGRTIPADGNFFTYTRHEPVGVCGQIIPWNFPLVMLVWKI
APALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDID
KVAFTGSTEVGKMIKEAAGKSNLKRVTLELGGKSPCIVFADADLDNAVESAHQGLFYHQG
QCCVAASRLFVEESIYDEFVKRSVERAKKYVLGNPLTPGVNQGPQIDKEQYDKILDLIES
GKKEGAKLECGGGPWGSKGYFIQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTHYGLSAGIFTKDLDKAVTVSSALQAGTVWVNCYSMVSAQCPFGGFKMSGNGRELGE
YGLHEYTEVKTVTMKISQKNS
Download sequence
Identical sequences H0XAS5
ENSOGAP00000012741 ENSOGAP00000012741 XP_003783003.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]