SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012925 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012925
Domain Number 1 Region: 12-239
Classification Level Classification E-value
Superfamily Heme oxygenase-like 2.78e-72
Family Eukaryotic type heme oxygenase 0.0000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012925   Gene: ENSOGAG00000014421   Transcript: ENSOGAT00000014426
Sequence length 289
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:12074276:12083311:-1 gene:ENSOGAG00000014421 transcript:ENSOGAT00000014426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHPQSDSMPQDLSEAMKEATKEVHTQAENTEFMRNFQKGQVNREGFKLVMASLYHIYVA
LEEEIERNKGNPVYSPLYFPEELHRRAVLEQDMAFWYGPHWQEEIPYTPATQRYVQRLHE
VGRAEPELLVAHTYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIVSATKFKQ
LYRSRMNSLEMTPEVKQRVVEEAKTAFLLNIQLFEELQQLLAEDTKEQSPSKAERLRRRV
PGKITNVTPMETPRGKPQPNVLSQAPLLRWVLTLSFLVATVAAVGLYAM
Download sequence
Identical sequences H0XB70
ENSOGAP00000012925 ENSOGAP00000012925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]