SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013080 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013080
Domain Number 1 Region: 32-130
Classification Level Classification E-value
Superfamily POZ domain 2.94e-29
Family Tetramerization domain of potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013080   Gene: ENSOGAG00000014600   Transcript: ENSOGAT00000014605
Sequence length 258
Comment pep:known_by_projection scaffold:OtoGar3:GL873531.1:24545725:24594423:1 gene:ENSOGAG00000014600 transcript:ENSOGAT00000014605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NMSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRL
FDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQP
MLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSV
NAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRREL
RRTPRVPSVIRIKQEPLD
Download sequence
Identical sequences F7I997 H0XBJ6
ENSOGAP00000013080 ENSOGAP00000013080 ENSCJAP00000038557 ENSPANP00000004084 ENSGGOP00000013223 9615.ENSCAFP00000026783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]