SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013132 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013132
Domain Number 1 Region: 5-262
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.53e-103
Family Carbonic anhydrase 0.0000000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013132   Gene: ENSOGAG00000014659   Transcript: ENSOGAT00000014661
Sequence length 264
Comment pep:known_by_projection scaffold:OtoGar3:GL873670.1:2192888:2201889:-1 gene:ENSOGAG00000014659 transcript:ENSOGAT00000014661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGHHGWGYGQDDGPSHWHKLYPIAQGDRQSPINIVSSQAVYSPSLRPLEISYEACMSLS
ITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDTGSEHTVDGKSFPSEL
HLVHWNAKKYSTFGEAASAPDGLAVVGIFLETGDEHPSMNRLTDALYMVRFKGTKAQFSC
FDPKCLLPASRHYWTYPGSLTTPPLSESVTWIVLREPIRVSERQMEKFRSLLFTSEDDER
IHMVNNFRPPQPLKGRVVKASFQA
Download sequence
Identical sequences H0XBN7
ENSOGAP00000013132 ENSOGAP00000013132 XP_003799468.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]