SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013162 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013162
Domain Number 1 Region: 11-191
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 3.92e-50
Family Isochorismatase-like hydrolases 0.0000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013162   Gene: ENSOGAG00000014689   Transcript: ENSOGAT00000014695
Sequence length 205
Comment pep:known_by_projection scaffold:OtoGar3:GL873783.1:437397:440064:1 gene:ENSOGAG00000014689 transcript:ENSOGAT00000014695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMAGRPSLGRVLPGSSVLFLCDMQEKFRHHIAYFPQIVSVAARMLRVARLLEVPAVLTEQ
YPEGLGSTVPELGAEGLRPLPKTCFSMVPALHQELDSWPQLRSVLLCGIETQACILNTAL
DLLDRGLQVHVVVDACSSRSQVDRLVALARMRQSGAFLSTSEGLILQLVGDAAHPQFKEI
QKIIKDPAPDSGLLGLFQGQNPLFR
Download sequence
Identical sequences H0XBR3
ENSOGAP00000013162 ENSOGAP00000013162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]