SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013242 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013242
Domain Number 1 Region: 18-113
Classification Level Classification E-value
Superfamily POZ domain 3.93e-27
Family Tetramerization domain of potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 212-449,517-573
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.62e-19
Family WD40-repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013242   Gene: ENSOGAG00000014778   Transcript: ENSOGAT00000014784
Sequence length 815
Comment pep:known_by_projection scaffold:OtoGar3:GL873687.1:3455581:3521557:-1 gene:ENSOGAG00000014778 transcript:ENSOGAT00000014784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGHCGSFAAAAAGSGEIVQLNVGGTRFSTSRQTLMWIPDSFFSSLLSGRISTLRDETG
AIFIDRDPAAFAPILNFLRTKELDLRGVSINVLRHEAEFYGITPLVRRLLLCEELERSSC
GSVLFHGYLPPPGIPSRKINNTARSADSRNGLNSTEGEARGNGTQPVLSGSGEETVKLGF
PVDPRKVLIVAGHHNWIVAAYAHFAVCYRIKESSGWQQVFTSPYLDWTIERVALNAKVVG
GPHGDKDKMVAVASESSIILWSIQDGGSGSEIGVFSLGVPVDALFFIGNQLVATSHTGKV
GVWNAVTQHWQVQDVVPITSYDTAGSFLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELY
HDPSNDAITALSVYFTPKTSVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVH
RSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLEETESHG
SYSSGNDIGPFGERDDQQVFIQKVVPITNKLFVRLSSTGKRICEIQAVDCTTISSFTVRE
CEGSSRMGSRPRRYLFTGHTNGSIQMWDLTTAMDMVNKSEDKDVGGPTEEELLKLLDQCD
LSTSRCATPNISPATSVVQHSRLRESNSSLQLQHHETIHEAATYGSIRPYRESPLLARAR
RTESFHSYRDFQTVNLNRNVERAVPENGNLGPIQTEVKGATGEYSTSERKSPGTEIKSLR
ELDSGLEGHKTAEGFSESKKRSSEDENENKVELRKKGGFEGGGFLGRKKVPYLVSSPSTS
DGGADSPGTASPSPTKTTPSPRHKKSDSSGQEYSL
Download sequence
Identical sequences H0XBX5
ENSOGAP00000013242 ENSOGAP00000013242 XP_003800191.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]