SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013279 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013279
Domain Number 1 Region: 155-273
Classification Level Classification E-value
Superfamily DNA clamp 1.04e-17
Family DNA polymerase processivity factor 0.013
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000013279
Domain Number - Region: 28-124
Classification Level Classification E-value
Superfamily DNA clamp 0.00722
Family DNA polymerase processivity factor 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013279   Gene: ENSOGAG00000014822   Transcript: ENSOGAT00000014826
Sequence length 282
Comment pep:known_by_projection scaffold:OtoGar3:GL873582.1:3363263:3369458:-1 gene:ENSOGAG00000014822 transcript:ENSOGAT00000014826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQHIEDENDQYSLVASLDNVRNLSTILKAIHFQDYATCFATKNGIKVTVENAKCVQ
ANAFIQAGIFQEFTVQEESITFRINLTVLLDCLSIFGSSPTPGTLTALRMCYQDYGYPLM
LFLEEGGVVTVCKINTQEPVETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQIT
MSPEKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNETQVNRYKISLLKPSTKALVLSCK
VSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEVVPESES
Download sequence
Identical sequences H0XC10
ENSOGAP00000013279 ENSOGAP00000013279 XP_012662553.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]