SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013335 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013335
Domain Number 1 Region: 337-426
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.11e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 163-215
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000693
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 60-119
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000864
Family HLH, helix-loop-helix DNA-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013335   Gene: ENSOGAG00000014886   Transcript: ENSOGAT00000014892
Sequence length 932
Comment pep:known_by_projection scaffold:OtoGar3:GL873571.1:4830286:5675595:-1 gene:ENSOGAG00000014886 transcript:ENSOGAT00000014892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAGAAANGTPQNVQGITSYQQRITAQHPLPNQSECRKIYRYDGIYCESTYQNLQALRK
EKSRDAARSRRGKENFEFYELAKLLPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPP
WNLRMEGPPPNTSVKGAQRRRSPSALAIEVFEAHLGSHILQSLDGFVFALNQEGKFLYIS
ETVSIYLGLSQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGAAEDGASSASS
SSQSETPEPVESTSPSLLTTDNTLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLR
VSLSHGRTVPSQIMGLVVVAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMD
LTPVDIVGKRCYHFIHAEDVEGIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIA
INAKNANEKNIIWVNYLLSNPEYKDTPMDIAQLPHMPEKTSESSETSDSESDSKDTSGIT
EDNDNSKSDEKGNHSENSEDPEPDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHS
DFENPKAAEDGFGALGPMQIKVERYVESESDLRLQNCDSLTSDSAKDSDSAGEAGAQASS
KHQKRKKRRKRQKGGSASRRRLSSASSPGGLDAGLVEAPRLLSSPNSASVLKIKTEISEP
INFDNDSSIWNYPPNREISRNESPYSMTKPPSSEHFPSPQGGSGGGSGGGGGGLHVAIPD
SVLTPPGADGAAARKTQFSGSAASALAPVASDPLSPPLSASPRDKHPGGGGGGGGGPSAS
NSLLYTGDLEALQRLQAGNVVLPLVHRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAMQ
GNLLPNAHAVNFVDVNSPGFGLDPKTPMEMLYHHVHRLNMSGPFGGAVSAASLTQMPAGN
VFTTAEGLFSTLPFPVYSNGIHAAQTLERKED
Download sequence
Identical sequences H0XC56
ENSOGAP00000013335 ENSOGAP00000013335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]