SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013406 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013406
Domain Number 1 Region: 120-368
Classification Level Classification E-value
Superfamily vWA-like 9.34e-83
Family Integrin A (or I) domain 0.0000000194
Further Details:      
 
Domain Number 2 Region: 364-454
Classification Level Classification E-value
Superfamily Integrin domains 4.24e-30
Family Integrin domains 0.0000954
Further Details:      
 
Domain Number 3 Region: 620-702
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.48e-18
Family Integrin beta tail domain 0.0004
Further Details:      
 
Domain Number 4 Region: 13-65
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000241
Family Plexin repeat 0.00072
Further Details:      
 
Domain Number 5 Region: 579-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family Integrin beta EGF-like domains 0.0026
Further Details:      
 
Domain Number 6 Region: 536-574
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000013406
Domain Number - Region: 505-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family Integrin beta EGF-like domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013406   Gene: ENSOGAG00000014972   Transcript: ENSOGAT00000014978
Sequence length 786
Comment pep:known_by_projection scaffold:OtoGar3:GL873608.1:888958:998319:1 gene:ENSOGAG00000014972 transcript:ENSOGAT00000014978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIGTSSSCFEGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSVTSRCDLRANLVRN
GCGGEIESPASSTRVLRSLPLSSKGSSSVGADVIQMTPQEIAVSLRPGDKTAFQLQVRQV
EDYPVDLYYLMDLSLSMKDDLDNIRNLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYV
APRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAI
LQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQ
MDYPSLALLGEKLAENNINLIFAVTKNHYTLYKNFTALIPGTTVEILHGDSKNIIQLIIN
AYNSIRSKVELSVWDQPEELNLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSVEARSC
PMRRTEHVFTLRPVGFRDSLEVGVAYNCKCDCSAGLEPNSARCSGNGTYACGLCECNPSH
LGTRCECQEGENQSMYQNLCREAEGKPLCSGRGDCSCNQCSCFESEFGKIYGPFCECDNF
SCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCTTDISTCRAKDGQICSDRGHCVCGQC
QCTEPGAFGETCEKCPTCPDACSTKRDCVECLLRHSGKGDNQTCQSLCKDEVITWVDTIV
KDDQEAVLCFYKTAKDCVMLFTYTELPSGKSNLTVLREPECGTAPNAMTILLIVVGSILL
IGIALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPISTHTVDFTFNKFNKS
YNGTVD
Download sequence
Identical sequences H0XCA8
ENSOGAP00000013406 ENSOGAP00000013406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]