SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013664 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013664
Domain Number 1 Region: 324-614
Classification Level Classification E-value
Superfamily Kelch motif 4.18e-77
Family Kelch motif 0.0000844
Further Details:      
 
Domain Number 2 Region: 8-62,119-183
Classification Level Classification E-value
Superfamily POZ domain 1.49e-28
Family BTB/POZ domain 0.005
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000013664
Domain Number - Region: 80-106
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0115
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013664   Gene: ENSOGAG00000015258   Transcript: ENSOGAT00000015262
Sequence length 630
Comment pep:known_by_projection scaffold:OtoGar3:GL873531.1:18712062:18804881:1 gene:ENSOGAG00000015258 transcript:ENSOGAT00000015262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAVLASCSQYFRS
LFSSHPPLVGGVGGQDGLGAPKDQQQQPQQQQPSQQQQQPPPQEEPGTPSSSPDDKLLTS
PRAINNLVLQGCSSIGLRLVLEYLYTANVTLSLDTVEEVLSVSKILHIPQVTKLCVQFLN
DQISVQNYKQVCKIAALHGLEETKKLANKYLVEDVLLLNFEEMRALLDSLPPPVESELAL
FQMSVLWLEHDRETRMQYAPDLMKRLRFALIPAPELVERVQSVDFMRTDPVCQKLLLDAM
NYHLMPFRQHCRQSLASRIRSNKKMLLLVGGLPPGPDRLPSNLVQYYDDEKKTWKILTIM
PYNSAHHCVVEVENFLFVLGGEDQWNPNGKHSTNFVSRYDPRFNSWIQLPPMQERRASFY
ACRLDKHLYVIGGRNETGYLSSVECYNLETNEWRYVSSLPQPLAAHAGAVHNGKIYISGG
VHNGEYVPWLYCYDPVMDVWARKQDMNTKRAIHTLAVMNDRLYAIGGNHLKGFSHLDVML
VECYDPKGDQWNILQTPILEGRSGPGCAVLDDSIYLVGGYSWSMGAYKSSTICYCPEKGT
WTELEGDVAEPLAGPACATVILPACVPYNK
Download sequence
Identical sequences H0XCW7
XP_003784804.1.62490 ENSOGAP00000013664 ENSOGAP00000013664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]