SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013718 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013718
Domain Number 1 Region: 29-146
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-43
Family FKBP immunophilin/proline isomerase 0.000000635
Further Details:      
 
Domain Number 2 Region: 258-414
Classification Level Classification E-value
Superfamily TPR-like 1.11e-33
Family Tetratricopeptide repeat (TPR) 0.000000147
Further Details:      
 
Domain Number 3 Region: 142-257
Classification Level Classification E-value
Superfamily FKBP-like 5.89e-27
Family FKBP immunophilin/proline isomerase 0.00000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013718   Gene: ENSOGAG00000015316   Transcript: ENSOGAT00000015320
Sequence length 458
Comment pep:known_by_projection scaffold:OtoGar3:GL873623.1:5801668:5810885:-1 gene:ENSOGAG00000015316 transcript:ENSOGAT00000015320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEEMKAAESGVQSAPLPLEGVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGW
LLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPP
KIPPNATLVFEVELFEFKGEDLTEDEDGGIIRRIQTRGEGYARPNEGAIVEVALEGYYKD
QLFDQREFSFEVGEGESLDLPCGLERAIQRMEKGEHSILYLKPSYAFGSVGNENFHIPPF
AELKYKVHLKNFEKAKESWEMSSEEKLEQSTIVKERGTVYFKDGKYKQAVLQYKKIVSWL
EYELGFSGEKAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRG
EAHLAVNDYDLARADFQKVLQLYPSNKAAKAQLAVCQQRIRKQLAREKKLYANMFERLAE
EESKAKAGVAAGDHPTDTEMKDTEKNMARSQSQVETEA
Download sequence
Identical sequences H0XD13
ENSOGAP00000013718 XP_003796486.1.62490 ENSOGAP00000013718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]