SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013808 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013808
Domain Number 1 Region: 927-1264
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 6.02e-116
Family Methionine synthase SAM-binding domain 0.0000000471
Further Details:      
 
Domain Number 2 Region: 21-414
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 5.89e-110
Family Homocysteine S-methyltransferase 0.0000118
Further Details:      
 
Domain Number 3 Region: 371-645
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 3.79e-86
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00053
Further Details:      
 
Domain Number 4 Region: 769-921
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 5.76e-44
Family Cobalamin (vitamin B12)-binding domain 0.00000265
Further Details:      
 
Domain Number 5 Region: 665-754
Classification Level Classification E-value
Superfamily Methionine synthase domain 1.22e-26
Family Methionine synthase domain 0.0000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013808   Gene: ENSOGAG00000015411   Transcript: ENSOGAT00000015425
Sequence length 1265
Comment pep:known_by_projection scaffold:OtoGar3:GL873831.1:211652:323443:-1 gene:ENSOGAG00000015411 transcript:ENSOGAT00000015425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPALSQPSFKAGLKKTLRDEIEAILRRRIMVLDGGMGTMIQRHKLSEEHFQGQEFKDHS
RPLKGNNDILSITQPDIIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYQMNKC
SAGVARKAAEEITLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYEEQA
KGLLDGGVDILLIETIFDTANAKAALFALQKLFEEKYDPRPIFISGTIVDKSGRTLSGQT
GEAFVISVSHADCLCIGLNCALGAAEMRPFIETIGKCTTAYVLCYPNAGLPNTFGDYDET
PSVMATYLKDFAMDGLVNIVGGCCGSTPDHLREIAKAVKNCKPRVPPATVFEGHMLLSGL
EPFKIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALSVAKVQVEMGAQILDINMDDG
MLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCSQGKCIVNSISLKEGEED
FLEKAKKIKKYGAAVVVMAFDEEGQATETDTKIEVCTRAYQLLVKNLGFNPNDIIFDPNI
LTIGTGMEEHNWYAVNYIHATKVIKETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLY
HAIKFGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLRYAQTHGKGGKKV
IQTDEWRTGPVEERLEYALVKGIEKHIIEDTEEARLNQEKYPRPLNIIEGPLMNGMKVVG
DLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETRVLNGTVEEEDPYQGTIVLATV
KGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCEKILKAAIDHKADIIGLSGLITPSLDEM
IFVAKEMERLAIKIPLLIGGATTSRTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDEN
LKDEYFEEIMEEYEDIRQDHYESLKEKRYLSLSQARKNGFRIDWLSEPCPVKPTFTGTRV
FADYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGEEARKVYDDAQNMLNTL
ISQKKLQARGVVGFWPAQSVQDDIHLYAEDAVPQAAEPIATFHGLRQQAEKDSASTEPYY
CLSDFIAPLHSGVRDYLGLFAVACFGVEELSKAYEDDSDDYSSIMVKALGDRLAEAFAEE
LHERVRRELWAYCGSERLDVADLRRLRYEGIRPAPGYPSQPDHTEKLSMWQLADIEQATG
IRLTESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQIEDYALRKNMSVAEVEKWLGPIL
GYDTD
Download sequence
Identical sequences H0XD77
ENSOGAP00000013808 ENSOGAP00000013808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]